Category: TUGAS BAHASA INDONESIA

KOMENTAR UNTUK MAHASISWA YANG TAMPIL BERPIDATO

1.Titus nova halhandaka
Komentar :
Pembawaan saudari Titus sudah baik,sudah interaktif terhadap penonton,sedikit gerogi,EYD dan Baku bahasanya,sopan dalam penyampaian materi,materi yang dibawa kurang gregetnya tetapi sudah memenuhi syarat dalam pembawaan pidato tersebut,dan bisa dibilang sudah menguasai mater,apabila didalami lagi teknik pidato sapat menghasilkan pidato yang maksimal

. 2. M. Nur Fitriyanto
Komentar :
Materi yang disampaikan sudah lengkap atau berbobot tetapi lebih baik materinya tidak terlalu menjelaskan faktor kesehatan melainkan faktor – faktor yang dapat memajukan pertanian organik tersebut,sedikit gerogi,penampilan yang menarik,kurang interaktif dengan penonton,sopan dalam penyampaian materi,bahasa yang dipakai sudah EYD dan baku,apabila didalami lagi teknik pidato sapat menghasilkan pidato yang maksimal

3. Septi Mustika.
Komentar :
Pembawaan saudari septi mustika sudah baik,tidak gerogi,materinya sudah baik tetapi tidak interaktif terhadap penonton sehingga penonton agak bosan,percaya diri yang baik,bahasa yang dipakai juga baik sesuai EYD dan baku,kalau bisa diiringi dengan contoh atau pengaplikasiaanya,apabila didalami lagi teknik pidato sapat menghasilkan pidato yang maksimal

4.Yudi Aditya
Komentar :
Dalam hal ini saya belum bisa menilai pidato saudara yudi aditia,dikarenakan saudara yudi kurang siap dalam menyampaikan pidato,dan penyampaian pidato baru sebatas perkenalan dan sedikit penyampaian materi,tetapi di lain hari mungkin saudara yudi aditia dapat menyampaikan pidato tersebut secara maksimal

5. Rahman Mulyadi
Komentar :
Pidato yang dibawakan oleh saudara rahman mulyadi sudah maksimal,sopan dalam penyampaian pidato,percaya diri yang baik,penguasaan materi yang baik,mungkin saran dari saya tingkatkan dalam penyampaian pengaplikasiaan atau informasi yang lebih banyak dan menarik perhatian penonton

6. Agus Supriyanto.
Komentar :
Pembawaan pidato saudara agus sudag baik,tetapi kurang dalam penguasaan materi,bahasa yang dipakai sopan dan baku,percaya diri yang baik,materi yang disampaikan singkat mungkin dalam penyampaian informasinya lebih ditingkatkan di lain hari agar memperoleh pidato yang maksimal

7. Joni
Komentar :
Pidato yang disampaikan oleh Joni sudah baik,kurang interaktif terhadap penonton,materi yang dipakai padat dan singkat,percaya diri saudara joni sudah baik,kurang informatif dalam penyampaian materi pidato

8. Andreas Damanik.
Komentar :dikarenakan saya sendiri dalam berpidato saran dan kritik yang saya ambil dari kawan saya, berikut saran dan kritiknya :
Pidato yang dibawakan oleh Andreas bagus, menguasai materi, penampilan menarik, materi yang disampaikan bagus, sesuai dengan kerangka pidato, intonasi yang digunakan tepat, selain itu menggunakan EYD yang baik dan bahasa yang sopan, namun terlalu singkat,tetapi terdapat pantun sebagai penutup dan ini menjadi daya tarik tersendiri.

9. Zulpa Khoriyah
Komentar :
pembawaan pidato zulpha sudah menarik dan baik,materinya sudah dikuasai,pengaplikasian materi baik,sedikit humoris dapat menjadi daya tarik,mungkin di lain hari dapat ditingkatkaan lagi

Syarat – syarat pidato yang baik dan benar (Hal yang Harus Diperhatikan dalam berpidato)

Dalam berpidato diperlukan beberapa teknik , unsur, dan cara berpidato. Mempelajari sebab dari munculnya faktor-faktor yang dapat mempengaruhi efektifitas pada pidato sangat penting sehingga kita dapat menaggulangi faktor-faktor tersebut .

Terkadang muncul beberapa faktor yang mempengaruhi efektifitas pidato yang membuat penceramah menjadi terganggu dalam penyampaian ceramah pidatonya. Dari faktor-faktor tersebut terbagi menjadi dua macam faktor umum yaitu adanya faktor internal (dari dalam diri seseorang penceramah ) dan faktor eksternal (dari luar ).

Faktor internal muncul dari dalam diri orator dan biasanya itu terjadi tanpa disengaja atau spontan, bisa juga faktor intern muncul dikarenakan orator kurang begitu menguasai audien, materi maupun panggunaan.
Image
Faktor eksternal biasanya terjadi karena adanya gangguan dari luar yang mungkin menggangu orator dalam menyampaikan ceramah pidatonya. Dari faktor tersebut seharusnya orator dapat menyadari beberapa kesalahan yang terjadi pada saat berpidato sehingga dapat memperbaiki kesalahan tersebut.

Berikut hal-hal yang perlu diperhatikan dalam berpidato :

a.Akitivitas di Mimbar

1.Penampilan
a). Pakaian harus rapi
b). Wajah selalu senyum
c). Sikap badan tegak dan santai
d). Adanya keseimbangan gerak
e). Adanya keserasian dalam pembicaraan

2.Menumbuhkan percaya diri
3.Pandangan, harus :
a). Seramah mungkin
b). Adanya kontak mata dengan audience
c). Pandangan merata keseluruh audience

b.Sikap seorang penceramah itu harus serba menarik :
1.Sikapnya
2.Air mukanya
3.Pakaianya
4.Ucapanya
5.Gerak-geriknya
6.Rias ( make up )

c.Suara seorang penceramah itu harus :
1.Dapat didengar
2.Pengaturan intonasi
3.Bahasa bervariasi
4.Disesuaikan dengan intonasi dan kondisi
5.Usai pidato nada kalem

Image

d.Gaya penyampaian pidato harus :
1.Adanya selingan seperti humor ( metode cerita, plesetan kata-kata, kombinasi lagu-lagu, pergaan )
2.Sekali-kali dapat digunakan suatu pertanyaan
3.Adanya do’a sebagai kekuatan dalam berpidato
4.Aluna suara yang syahdu ( aura, nuansa, suasana )
Berikut ini kesalahan yang sering terjadi dalam berpidato :

a.Kesalahan dalam penampilan dan sikap :
1.Penampilan yang tidak bersemangat
2.Kurang ada kontak mata dengan pendengar
3.Hanya mengarahkan mata dan perhatian pada satu titik atau tempat didalam ruangan
4.Gerak-gerik yang tidak terkontrol
5.Tangan dimasukan kedalam jaket atau saku celana
6.Berdiri sambil memeluk atau menaruh perut pada mimbar
7.Tidak tenang melenggang kesana kemari

b.Kesalahan dalam berbicara :
1.Terlalu banyak mengulang
2.Tempo bicara yang terlalu cepat
3.Suara yang monoton tidak ada tinggi rendah
4.Terlalu banyak bunyi-bunyian yang menggangu sebagai tanda bahwa orang tidak menguasai bahan misalnya : eh,e,u…dll
5.Penggunaan dan penerapan kata-kata asing yang salah

Didalam berpidato kita harus mempunyai prinsip dan watak yang tangguh dalam menyampaikan ceramah pidato. Ada beberapa faktor yang mempengaruhi jalanya pidato :

Faktor Intern
1. Pembinaan Teknik Berbicara
Teknik Berbicara merupakan bentuk dari efektifitas monologikal dan dialogika tergantung pada teknik berbicara yang meliputi unsur teknik bernafas,mengucap, dan binasuara.

2 Berbicara
Sebagai calon pembicara atau orator hendaklah memiliki syarat-syarat sebagai berikut :
a. Adanya minat
b. Keberanian tampil (dihadapan publik)
c. Memiliki kemampuan menyampaikan
d. Memiliki suara yang baik
e. Simpatik
f. Berbakat

Faktor Ekstern
1. Suara luar yang mengangu misanya seperti suara gema atau salon yang terlalu dekat
2. Audience yang ribut
3. Cuaca
Sudahkah anda memenuhi syarat berpidato yang baik seperti hal diatas..?? 

Pengertian & Syarat Pidato

Pidato merupakan kegiatan seseorang yang dilakukan di hadapan orang banyak dengan mengandalkan kemampuan bahasa sebagai alatnya. Pada saat berpidato sudah dapat dipastikan bahwa akan terjadi hubungan antara yang berpidato dengan yang diberi pidato. Oleh sebab itu maka yang berpidato (pemidato) hendaknya mempersiapkan dirinya dengan sebaik-baiknya, agar tercapai apa yang diharapkannya.

Image

 

Beberapa fungsi pidato antara lain :

 1. Menyampaikan informasi kepada pendengarnya.

 2. Mendidik.

 3. Mempengaruhi pendengar.

 4. Menghibur.

 5. Propaganda.

 6. Penyambung lidah orang.

 

Dengan melihat beberapa fungsi pidato itu maka seseorang dapat dengan lebih jelas menentukan sikap pada saat akan atau ketika berpidato, bahkan dengan mengetahui manfaat tersebut seseorang yang berpidato dapat mengukur, apakah pidatonya itu berhasil atau gagal.

 

Berpidato yang baik harus memperhatikan beberapa syarat, diantaranya :

 

1. Berbusana yang sopan dengan melihat situasi, macam latar belakang pendengarnya, acara yang akan disuguhkan panitia.

 2. Pergunakan bahasa yang sopan dan komunikatif sesuai dengan tingkat bahasa pendengarnya. Pergunakan bahsa baku jika berpidao dalam forum resmi, misalnya : seminar, rapat, sidang dsb.

 3. Materi pidato harus sesuai dengan yang diinginkan pndengar. Jangan menggunakan materi yang justru bertentangan dengan kemauan, adat, norma, agama atau tatanan yang dianut oleh masyarakat pendengar.

 4. Penampilan harus dengan rasa percaya diri, tidak minder rendah diri, takut, bingung atau grogi. Jangan memfonis pendengar dengan memaksakan pendapat atau kehendak.

Image

Syarat – syarat pidato yang baik dan benar (Hal yang Harus Diperhatikan dalam berpidato)

Dalam berpidato diperlukan beberapa teknik , unsur, dan cara berpidato. Mempelajari sebab dari munculnya faktor-faktor yang dapat mempengaruhi efektifitas pada pidato sangat penting sehingga kita dapat menaggulangi faktor-faktor tersebut .
Image

Terkadang muncul beberapa faktor yang mempengaruhi efektifitas pidato yang membuat penceramah menjadi terganggu dalam penyampaian ceramah pidatonya. Dari faktor-faktor tersebut terbagi menjadi dua macam faktor umum yaitu adanya faktor internal (dari dalam diri seseorang penceramah ) dan faktor eksternal (dari luar ). Faktor internal muncul dari dalam diri orator dan biasanya itu terjadi tanpa disengaja atau spontan, bisa juga faktor intern muncul dikarenakan orator kurang begitu menguasai audien, materi maupun panggunaan.

ImageH

Faktor eksternal biasanya terjadi karena adanya gangguan dari luar yang mungkin menggangu orator dalam menyampaikan ceramah pidatonya. Dari faktor tersebut seharusnya orator dapat menyadari beberapa kesalahan yang terjadi pada saat berpidato sehingga dapat memperbaiki kesalahan tersebut.

Berikut hal-hal yang perlu diperhatikan dalam berpidato :
Berikut hal-hal yang perlu diperhatikan dalam berpidato :
a.Akitivitas di Mimbar
1.Penampilan
a). Pakaian harus rapi
b). Wajah selalu senyum
c). Sikap badan tegak dan santai
d). Adanya keseimbangan gerak
e). Adanya keserasian dalam pembicaraan
2.Menumbuhkan percaya diri
3.Pandangan, harus :
a). Seramah mungkin
b). Adanya kontak mata dengan audience
c). Pandangan merata keseluruh audience
b.Sikap seorang penceramah itu harus serba menarik :
1.Sikapnya
2.Air mukanya
3.Pakaianya
4.Ucapanya
5.Gerak-geriknya
6.Rias ( make up )
c.Suara seorang penceramah itu harus :
1.Dapat didengar
2.Pengaturan intonasi
3.Bahasa bervariasi
4.Disesuaikan dengan intonasi dan kondisi
5.Usai pidato nada kalem
d.Gaya penyampaian pidato harus :
1.Adanya selingan seperti humor ( metode cerita, plesetan kata-kata, kombinasi lagu-lagu, pergaan )
2.Sekali-kali dapat digunakan suatu pertanyaan
3.Adanya do’a sebagai kekuatan dalam berpidato
4.Aluna suara yang syahdu ( aura, nuansa, suasana )
Berikut ini kesalahan yang sering terjadi dalam berpidato :
a.Kesalahan dalam penampilan dan sikap :
1.Penampilan yang tidak bersemangat
2.Kurang ada kontak mata dengan pendengar
3.Hanya mengarahkan mata dan perhatian pada satu titik atau tempat didalam ruangan
4.Gerak-gerik yang tidak terkontrol
5.Tangan dimasukan kedalam jaket atau saku celana
6.Berdiri sambil memeluk atau menaruh perut pada mimbar
7.Tidak tenang melenggang kesana kemari
b.Kesalahan dalam berbicara :
1.Terlalu banyak mengulang
2.Tempo bicara yang terlalu cepat
3.Suara yang monoton tidak ada tinggi rendah
4.Terlalu banyak bunyi-bunyian yang menggangu sebagai tanda bahwa orang tidak menguasai bahan misalnya : eh,e,u…dll
5.Penggunaan dan penerapan kata-kata asing yang salah

Didalam berpidato kita harus mempunyai prinsip dan watak yang tangguh dalam menyampaikan ceramah pidato. Ada beberapa faktor yang mempengaruhi jalanya pidato :
Faktor Intern
1. Pembinaan Teknik Berbicara
Teknik Berbicara merupakan bentuk dari efektifitas monologikal dan dialogika tergantung pada teknik berbicara yang meliputi unsur teknik bernafas,mengucap, dan binasuara.
2 Berbicara
Sebagai calon pembicara atau orator hendaklah memiliki syarat-syarat sebagai berikut :
a. Adanya minat
b. Keberanian tampil (dihadapan publik)
c. Memiliki kemampuan menyampaikan
d. Memiliki suara yang baik
e. Simpatik
f. Berbakat
Faktor Ekstern
1. Suara luar yang mengangu misanya seperti suara gema atau salon yang terlalu dekat
2. Audience yang ribut
3. Cuaca
Sudahkah anda memenuhi syarat berpidato yang baik seperti hal diatas..?? 

Sumber : http://yuliantiez.blogspot.com/2009/01/taukan-anda-cara-berpidato-yang-benar.html

DEFINISI TANAH

                                            DEFINISI TANAH,
 PERTANYAAN AYUB NOVSEL SATYA SITUMORANG DARI MATERI DESDYAN RIZKI PRATAMA

1.Sifat Kimia Tanah?

2.Kesuburan biologi tanah meliputi apa saja? Apa itu?

3.Unsur Hara Mikro?

4.Siklus Unsur Hara tanah dapat dibedakan dengan?

5.Metode Pendekatan Kandungan unsur hara tanah?

 JAWABAN

1. Beberapa Sifat Kimia Tanah antara lain :

Derajat Kemasaman Tanah (pH)
Reaksi tanah menunjukkan sifat kemasaman atau alkalinitas tanah yang dinyatakan dengan nilai pH. Nilai pH menunjukkan banyaknya konsentrasi ion hidrogen (H+) di dalam tanah. Makin tinggi kadar ion H+ didalam tanah, semakin masam tanah tersebut. Di dalam tanah selain H+ dan ion-ion lain ditemukan pula ion OH-, yang jumlahnya berbanding terbalik dengan banyaknya H+. pada tanah-tanah masam jumlah ion H+ lebih tinggi daripada OH-, sedang pada tanah alkalis kandungan OH- lebih banyak daripada H+. Bila kandungan H+ sama dengan OH- , maka tanah bereaksi netral yaitu mempunyai pH = 7 (Anonim 1991).

Nilai pH berkisar dari 0-14 dengan pH 7 disebut netral sedangkan pH kurang dari 7 disebut masam dan pH lebih dari 7 disebut alkalis. Walaupun dcmikian pH tanah umumnya berkisar dari 3,0-9,0. Di Indonesia unumnya tanahnya bereaksi masam dengan 4,0 – 5,5 sehingga tanah dengan pH 6,0 – 6,5 sering telah dikatakan cukup netral meskipun sebenarnya masih agak masam. Di daerah rawa-rawa sering ditemukan tanah-tanah sangat masam dengan pH kurang dari 3,0 yang disebut tanah sangat masam karena banyak mengandung asam sulfat. Di daerah yang sangat kering kadang-kadang pH tanah sangat tinggi (pH lebih dari 9,0) karena banyak mengandung garam Na (Anonim 1991).

C-Organik
Kandungan bahan organik dalam tanah merupakan salah satu faktor yang berperan dalam menentukan keberhasilan suatu budidaya pertanian. Hal ini dikarenakan bahan organik dapat meningkatkan kesuburan kimia, fisika maupun biologi tanah. Penetapan kandungan bahan organik dilakukan berdasarkan jumlah C-Organik (Anonim 1991).
Bahan organik tanah sangat menentukan interaksi antara komponen abiotik dan biotik dalam ekosistem tanah. Musthofa (2007) dalam penelitiannya menyatakan bahwa kandungan bahan organik dalam bentuk C-organik di tanah harus dipertahankan tidak kurang dari 2 persen, Agar kandungan bahan organik dalam tanah tidak menurun dengan waktu akibat proses dekomposisi mineralisasi maka sewaktu pengolahan tanah penambahan bahan organik mutlak harus diberikan setiap tahun. Kandungan bahan organik antara lain sangat erat berkaitan dengan KTK (Kapasitas Tukar Kation) dan dapat meningkatkan KTK tanah. Tanpa pemberian bahan organik dapat mengakibatkan degradasi kimia, fisik, dan biologi tanah yang dapat merusak agregat tanah dan menyebabkan terjadinya pemadatan tanah (Anonim 1991).

N-Total
Nitrogen merupakan unsur hara makro esensial, menyusun sekitar 1,5 % bobot tanaman dan berfungsi terutama dalam pembentukan protein (Hanafiah 2005).
Menurut Hardjowigeno (2003) Nitrogen dalam tanah berasal dari :
a.Bahan Organik Tanah : Bahan organik halus dan bahan organik kasar
b.Pengikatan oleh mikroorganisme dari N udara
c.Pupuk
d.Air Hujan
Sumber N berasal dari atmosfer sebagai sumber primer, dan lainnya berasal dari aktifitas didalam tanah sebagai sumber sekunder. Fiksasi N secara simbiotik khususnya terdapat pada tanaman jenis leguminoseae sebagai bakteri tertentu. Bahan organik juga membebaskan N dan senyawa lainnya setelah mengalami proses dekomposisi oleh aktifitas jasad renik tanah.
Hilangnya N dari tanah disebabkan karena digunakan oleh tanaman atau mikroorganisme. Kandungan N total umumnya berkisar antara 2000 – 4000 kg/ha pada lapisan 0 – 20 cm tetapi tersedia bagi tanaman hanya kurang 3 % dari jumlah tersebut (Hardjowigeno 2003). Manfaat dari Nitrogen adalah untuk memacu pertumbuhan tanaman pada fase vegetatif, serta berperan dalam pembentukan klorofil, asam amino, lemak, enzim, dan persenyawaan lain (RAM 2007). Nitrogen terdapat di dalam tanah dalam bentuk organik dan anorganik. Bentuk-bentuk organik meliputi NH4, NO3, NO2, N2O dan unsur N. Tanaman menyerap unsur ini terutama dalam bentuk NO3, namun bentuk lain yang juga dapat menyerap adalah NH4, dan urea (CO(N2))2 dalam bentuk NO3. Selanjutnya, dalam siklusnya, nitrogen organik di dalam tanah mengalami mineralisasi sedangkan bahan mineral mengalami imobilisasi. Sebagian N terangkut, sebagian kembali scbagai residu tanaman, hilang ke atmosfer dan kembali lagi, hilang melalui pencucian dan bertambah lagi melalui pemupukan. Ada yang hilang atau bertambah karena pengendapan.

P-Bray
Unsur Fosfor (P) dalam tanah berasal dari bahan organik, pupuk buatan dan mineral-mineral di dalam tanah. Fosfor paling mudah diserap oleh tanaman pada pH sekitar 6-7 (Hardjowigeno 2003). Siklus Fosfor sendiri dapat dilihat pada Gambar 2.
Dalam siklus P terlihat bahwa kadar P-Larutan merupakan hasil keseimbangan antara suplai dari pelapukan mineral-mineral P, pelarutan (solubilitas) P-terfiksasi dan mineralisasi P-organik dan kehilangan P berupa immobilisasi oleh tanaman fiksasi dan pelindian (Hanafiah 2005).
Menurut Leiwakabessy (1988) di dalam tanah terdapat dua jenis fosfor yaitu fosfor organik dan fosfor anorganik. Bentuk fosfor organik biasanya terdapat banyak di lapisan atas yang lebih kaya akan bahan organik. Kadar P organik dalam bahan organik kurang lebih sama kadarnya dalam tanaman yaitu 0,2 – 0,5 %. Tanah-tanah tua di Indonesia (podsolik dan litosol) umumnya berkadar alami P rendah dan berdaya fiksasi tinggi, sehingga penanaman tanpa memperhatikan suplai P kemungkinan besar akan gagal akibat defisiensi P (Hanafiah 2005). Menurut Foth (1994) jika kekurangan fosfor, pembelahan sel pada tanaman terhambat dan pertumbuhannya kerdil.

Kalium (K)
Kalium merupakan unsur hara ketiga setelah Nitrogen dan Fosfor yang diserap oleh tanaman dalam bentuk ion K+. Muatan positif dari Kalium akan membantu menetralisir muatan listrik yang disebabkan oleh muatan negatif Nitrat, Fosfat, atau unsur lainnya. Hakim et al. (1986), menyatakan bahwa ketersediaan Kalium merupakan Kalium yang dapat dipertukarkan dan dapat diserap tanaman yang tergantung penambahan dari luar, fiksasi oleh tanahnya sendiri dan adanya penambahan dari kaliumnya sendiri.
Kalium tanah terbentuk dari pelapukan batuan dan mineral-mineral yang mengandung kalium. Melalui proses dekomposisi bahan tanaman dan jasad renik maka kalium akan larut dan kembali ke tanah. Selanjutnya sebagian besar kalium tanah yang larut akan tercuci atau tererosi dan proses kehilangan ini akan dipercepat lagi oleh serapan tanaman dan jasad renik. Beberapa tipe tanah mempunyai kandungan kalium yang melimpah. Kalium dalam tanah ditemukan dalam mineral-mineral yang terlapuk dan melepaskan ion-ion kalium. Ion-ion adsorpsi pada kation tertukar dan cepat tersedia untuk diserap tanaman. Tanah-tanah organik mengandung sedikit Kalium.

Natrium (Na)

Natrium merupakan unsur penyusun lithosfer keenam setelah Ca yaitu 2,75% yang berperan penting dalam menentukan karakteristik tanah dan pertumbuhan tanaman terutama di daerah kering dan agak kering yang berdekatan dengan pantai, karena tingginya kadar Na di laut, suatu tanah disebut tanah alkali jika KTK atau muatan negatif koloid-koloidnya dijenuhi oleh ≥ 15% Na, yang mencerminkan unsur ini merupakan komponen dominan dari garam-garam larut yang ada. Pada tanah-tanah ini, mineral sumber utamanya adalah halit (NaCl). Kelompok tanah alkalin ini disebut tanah halomorfik, yang umumnya terbentuk di daerah pesisir pantai iklim kering dan berdrainase buruk. Sebagaimana unsur mikro, Na juga bersifat toksik bagi tanaman jika terdapat dalam tanah dalam jumlah yang sedikit berlebihan (Hanafiah, 2005).

Kalsium (Ca)
Kalsium tergolong dalam unsur-unsur mineral essensial sekunder seperti Magnesium dan Belerang. Ca2+ dalam larutan dapat habis karena diserap tanaman, diambil jasad renik, terikat oleh kompleks adsorpsi tanah, mengendap kembali sebagai endapan-endapan sekunder dan tercuci (Leiwakabessy 1988). Adapun manfaat dari kalsium adalah mengaktifkan pembentukan bulu-bulu akar dan biji serta menguatkan batang dan membantu keberhasilan penyerbukan, membantu pemecahan sel, membantu aktivitas beberapa enzim (RAM 2007).

Magnesium (Mg)

Magnesium merupakan unsur pembentuk klorofil. Seperti halnya dengan beberapa hara lainnya, kekurangan magnesium mengakibatkan perubahan warna yang khas pada daun. Kadang-kadang pengguguran daun sebelum waktunya merupakan akibat dari kekurangan magnesium (Hanafiah 2005).

Kapasitas Tukar Kation (KTK)

Kapasitas tukar kation (KTK) merupakan sifat kimia yang sangat erat hubungannya dengan kesuburan tanah. Tanah-tanah dengan kandungan bahan organik atau kadar liat tinggi mempunyai KTK lebih tinggi daripada tanah-tanah dengan kandungan bahan organik rendah atau tanah-tanah berpasir (Hardjowogeno 2003). Nilai KTK tanah sangat beragam dan tergantung pada sifat dan ciri tanah itu sendiri. Besar kecilnya KTK tanah dipengaruhi oleh :
1.Reaksi tanah
2.Tekstur atau jumlah liat
3.Jenis mineral liat
4.Bahan organik dan,
5.Pengapuran serta pemupukan.
Soepardi (1983) mengemukakan kapasitas tukar kation tanah sangat beragam, karena jumlah humus dan liat serta macam liat yang dijumpai dalam tanah berbeda-beda pula.

Kejenuhan Basa (KB)

Kejenuhan basa adalah perbandingan dari jumlah kation basa yang ditukarkan dengan kapasitas tukar kation yang dinyatakan dalam persen. Kejenuhan basa rendah berarti tanah kemasaman tinggi dan kejenuhan basa mendekati 100% tanah bersifal alkalis. Tampaknya terdapat hubungan yang positif antara kejenuhan basa dan pH. Akan tetapi hubungan tersebut dapat dipengaruhi oleh sifat koloid dalam tanah dan kation-kation yang diserap. Tanah dengan kejenuhan basa sama dan komposisi koloid berlainan, akan memberikan nilai pH tanah yang berbeda. Hal ini disebabkan oleh perbedaan derajat disosiasi ion H+ yang diserap pada permukaan koloid (Anonim 1991).
Kejenuhan basa selalu dihubungkan sebagai petunjuk mengenai kesuburan sesuatu tanah. Kemudahan dalam melepaskan ion yang dijerat untuk tanaman tergantung pada derajat kejenuhan basa. Tanah sangat subur bila kejenuhan basa > 80%, berkesuburan sedang jika kejenuhan basa antara 50-80% dan tidak subur jika kejenuhan basa < 50 %. Hal ini didasarkan pada sifat tanah dengan kejenuhan basa 80% akan membebaskan kation basa dapat dipertukarkan lebih mudah dari tanah dengan kejenuhan basa 50% (Anonim 1991).

(http://boymarpaung.wordpress.com/2009/02/19/sifat-kimia-tanah/)

 Image

2. KESUBURAN TANAH SECARA BIOLGI

 

Tanah dikatakan subur bila mempunyai kandungan dan keragaman biologi yang tinggi

 

 

 

 

Table 1. Maximum number and biomass (live weight) of soil organisms in a highly fertile grassland soil

 

Kind of organism

Abundance

(no/m2)

Biomass

(g/m2)

Bacteria

3 x 1014

300

Fungi

 

400

Protozoa

5 x 108

38

Nematodes

107

12

Earthworms and related forms

105

132

Mites

2 x 105

3

Springtails

5 x 104

5

Other invertebrates (snails, millipedes, etc)

2 x 103

36

From: B.N. Richards (1974) Introduction to the Soil Ecosystem

 

Organisme (mikroorganisme) tanah penting dalam kesuburan tanah karena

  1. berperan dalam siklus energi
  2. berperan dalam siklus hara
  3. berperan dalam pembentukan agregat tanah
  4. menentukan kesehatan tanah (suppressive / conducive terhadap munculnya penyakit terutama penyakit tular tanah-soil borne pathogen)

 

. Siklus energi

–          Sumber energi utama adalah matahari yang diubah oleh tanaman melalui proses fotosintesis menjadi bahan organik

–          Beberapa mikroorganisme mampu melakukan fotosinthesis (menangkap energi matahari: algae)

–          Sumber energi yang lain adalah hasil oksidasi-reduksi mineral anorganik: S dan Fe

–          Energi dalam bahan organik dimanfaatkan oleh organisme/mikroorganisme

–          Organisme dekomposer: milipede dll.

–          Mikroorganisme dekomposer: jamur dan bakteri

–          Mikroorganisme yang tumbuh di rhizosfer memanfaatkan energi dalam eksudat akar: bakteri Azotobacter

 

. Siklus hara

Mikroorganisme mempunyai peran yang sangat penting dalam siklus hara karena:

  1. ukurannya yang kecil sehingga mempunyai rasio permukaan:volume yang sangat besar

Þ memungkinkan pertukaran material (hara) dari sel ke lingkungannya dengan sangat cepat

  1. reproduksi yang sangat cepat (dalam hitungan menit)
  2. distribusi keberadaan yang sangat luas

 

Macam-macam siklus hara penting

  1. Siklus Nitrogen

–           Pool N terbesar di udara sebagai gas N2

–          N menjadi tersedia melalui proses fiksasi (kimia maupun mikrobiologis)

(nitrogen fixer: rhizobium dll)

–          N organik (dalam jaringan mahluk hidup – bentuk protein, asam amino dan asam nukleat) menjadi N anorganik melalui proses mineralisasi  NH4+ (ammonium) == MO dekomposer

–           NH4+  mengalami Nitrifikasi oleh Nitrosomonas, Nitrosococcus dan Nitrosovibrio

–          NO2  menjadi NO3  oleh Nitrobacter dan Nitrococcus

–          NO3  mengalami Denitrifikasi menjadi NO2  oleh Pseudomonas, Bacillus dan Alcaligenes

–          N anorganik dapat diasimilasi oleh mikroorganisme == Imobilisasi

 

 

  1. Siklus Sulfur

–          Oksidasi sulfur menjadi sulfat oleh Thiobacillus, Arthrobacter dan Bacillus

2H2S + O2   ® 2S + 2H2O

2S + 2H2O + 3O2   ®  2SO42- + 4H+

S2O32-  + H2O  + 2O2   ®  2SO42- + 2H+

 

–          Reduksi Sulfat menjadi sulfida (S2-) oleh Desulphovibrio desulphuricans

2SO42- + 4H2   ®  S2- + 4H2O

  1. Siklus fosfor

–          Fosfor di alam dalam bentuk terikat sebagai Ca-fosfat, Fe- atau Al-fosfat, fitat atau protein

–          Mikroorganisme (Bacillus, Pseudomonas, Xanthomonas, Aerobacter aerogenes) dapat melarutkan P menjadi tersedia bagi tanaman

 

 Pembentukan agregat tanah

–          organisme tanah menghasilkan polimer organik (misal humic dan fulvic acids) yang mengikat partikel lempung menjadi mikro agregat

–          pembentukan mikroagregat menjadi makro agregat dimediasi oleh bahan organik dan berbagai jenis mikro dan makroorganisme (bakteri, jamur-terutama jamur VAM, algae, cacing, semut, serangga dsb.).

 

. Kesehatan tanah

–          tanah suppressive terhadap patogen tular tanah umumnya mempunyai total mikroorganisme yang lebih besar dari tanah yang kondusif

–          kompetisi nutrisi

–          Amuba memakan jamur

–          populasi Pseudomonas spp (antagonistic bakteria) atau Trichoderma tinggi

Soil                                                      Fungi              Trichoderma

Fort Collins (condusive)(clay loam)                   2 x 103                1 x 102

Colombia (suppressive)(organic)                       1 x 108                8 x 105

PENILAIAN KESUBURAN TANAH

 

Penilaian kesuburan tanah merupakan proses yg mendiagnosis permasalahan unsure hara dan menerapkan anjuran dlm hal pemupukan.

Proses mendiagnosis msl unsur hara tnm dan menetapkan anjuran pupuk di wil tropika didasarkan pd pendekatan yg berbeda pd tahap kecanggihan yg berlainan

Program penilaian kesuburan tanah dpt dipilahkan menjadi: uji-tanah, analisis tanaman, omission element di rumah kaca, uji coba pupuk sederhana

 

  1. Berdasarkan pada uji-tanah

–          Salah satu pendekatan yg terpopuler

–          Dikembangkan oleh International Soil Fertility Evaluation and Improvement Program, ISFEIP.

–          Kesuburan tanah terutama bersangkut dg unsure hara tnm dan kead tanah

–          Penilaian menyangkut tk ketersediaan & kesetimbangan hara di dalam tanah, termasuk cara yg tepat untuk menaksir seluruh faktor tsb (uji-tanah, analisis tnm, sigi tanah, kead iklim)

–          Perbaikan meliputi penamb pupuk buatan, gamping, pupuk alam, dan tambahan lain pd tanah dlm jml, waktu & cara ttt, shg dpt memberi lingkungan hara yg optimum utk memperoleh hsl panen

–          Program penilaian & perbaikan tanah adl khas-tempat & khas keadaan.

–          Penggunaan informasi yg bijaksana mencakup pertimb thd bbrp faktor yg pengaruhi prod, tng kerja, ekonomi & ekologi

–          Hanya uji-tanah saja tidak dianggap sbg cara pendekatan yg memuaskan

–          Nilai yg diperoleh dlm analisis tanah adl angka empiris yg hanya berarti bila dikorelasikan dg tanggapan hasil

–          Menurut Fitts (1974) melibatkan :

    1. pengambilan contoh (tanah dan tanaman),  CT hrs benar2 mewakili tapak, krn hanya diuji sepermilyarnya
    2. analisis laboratorium (tanah dan tanaman), perlu metode yg sesuai dan benar
    3. hubungan antara analisis dan tanggapan hasil, di rumah kaca & uji coba lapangan
    4. penafsiran dan anjuran, berdasarkan hasil
    5. memanfaatkan informasi
    6. penelitian

 

  1. Berdasarkan analisis tanaman

–          berkembang di daerah tanpa system uji-tanah efektif

–          untuk tanaman tahunan dan jangka panjang

–          Keuntungannya: merangkumkan pengaruh peubah tanah, tanaman, iklim & pengelolaan

–          merup ukuran terakhir ketersediaan unsur hara

–          kerugiannya: terlambat untuk memperbaiki kondisi hara tanpa menderita kerugian hasil

–          Tujuan:

    1. Untuk mengenali masalah keharaan dan menetapkan jumlah perbaikannya melalui penentuan tingkat gawat
    2. Menghitung nilai penyerapan unsur hara sbg kunci utk penggunaan pupuk
    3. Memantau unsur hara tnm tahunan

 

  1. Berdasarkan pemantauan unsur hara yang hilang

–          Termsk menanam tnm penunjuk di dlm rumah kaca atau di lap pd tanah yg diberi pupuk scr omission element

–          Mnrt Chaminade (1972), informasi yg diperoleh adl:

    1. unsur hara yang kahat
    2. kepentingan nisbi kekahatan itu
    3. tingkat yg tunjukkan terkurasnya kesuburan akibat pemotongan/penebangan

 

  1. Uji coba pupuk scr sederhana di ladang petani

–          dikembangakan oleh Food and Agricultural Organization (FAO)

–          bertujuan utk memperkenalkan pupuk sbg sarana utk menaikkan hsl panen di tropika

–          mengesampingkan keaneka ragaman tanah setempat

–          tidak dapat dibuat anjuran khas-tempat

 

  1. Hubungan antara kesuburan tanah dan penggolongan tanah

–          anjuran penggunaan pupuk adalah khas-tempat

–          perbedaan sifat tanah merup salah satu penyebab utama utk kekhasan menurut tempat

–          program penilaian kesuburan tanah hrs berhub erat dg program penyigian dan penggolongan tanah

 

 

3.Unsur Hara Mikro

  • I PengertianUnsur Hara
    Unsur Hara adalahsenyawaorganikdananorganis yang adadidalamtanahataudengankata lain nutrisi yang terkandungdalamtanah
    Unsur Hara sangatdibutuhkanuntuktumbuhkembangtanaman. Berdasarkantingkatkebutuhannyamakadapatdigolongkanmenjadi 2 bagianyaituUnsur Hara MakrodanUnsur Hara Mikro
  • II DefinisiUnsur Hara Mikro
    Unsurharamikro, yaitu: sumbermakanan yang diperlukandalamjumlah yang relatifsedikit, namunsangatpentingdanmutlakdiperlukanolehtanamansebagaimakanan. Padahaliniunsurharamikrobanyakdiperolehdaribahanorganik yang adapadatanah
  • Sumberunsurharamikro : batu-batu mineral, air irigasidansisa-sisabahanorganis. Padaumumnyahanyasedikitdiperlukan, antarabeberapa gram sampai kilogram bagikeperluan 1 herktartanahdanpadaumumnyamerupakanzatkatalisatoratauzat yang dapatmempercepatpersenyawaankimiawidalamtubuhtanaman.
  • III FungsiUnsur Hara Mikro
    7 unsurharamikro yang dibutuhkantanamandalamjumlahkecilantara lain Besi(Fe), Mangaan(Mn), Tembaga (Cu), Seng (Zn), Boron (B), Molibden (Mo),, Klor(Cl). BerikutMasing-masingunsurharaesensialtidakdapatsalingmenggantikan.
  • G. klorofil
    Ferrit/besi (Fe) : dibutuhkantanamandalampembentukanklorofil, berperanpadaproses-prosesfisiologistanamansepertiprosespernapasan, selainitubesiberfungsisebagaiaktifatordalamprosesbiokimiadidalamtanaman, danpembentukbeberapaenzim.
  • Tembaga/Cupprum (Cu) : beperansebagaiaktfiatorenzimdalamprosespenyimpanancadanganmakanan, katalisatordalamprosespernapasandanperombakankarbohidrat, dansebagaisalahsatuelemendalamprosespembentukan vitamin A dansecaratidaklangsungberperandalampembentukanklorofil.
  • Seng/zink (Zn) :Kegunaansengsangatpentingantara lain sebagaikatalisatordalampembentukanprotein,mengaturpembentukanasam yang berfungsisebagaizatpengaturtumbuhtanaman. Ketersediaansengdalamtanah 1-20Ppm, sedangkankebutuhan normal tanaman 25-125ppm.
  • Boron (B) : Unsuriniberfungsimenangkutkarbohidratkedalamtubuhtanamandanmenghisapunsurkalsium. Selainitu boron berfungsidalamperkembanganbagian-bagiantanamanuntuktumbuhaktif. Gejaldefisiensiharamikroiniantara lain : pertumbuhanterhambatpadajaringanmeristematik (pucukakar), matipucuk (die back), mobilitasrendah, buah yang sedangberkembangsngatrentan, mudahterserangpenyakit. 
  • Molibden (Mo) : berperansebagaipengikat nitrogen  yang bebasdiudarauntukpembentukan protein danmenjadikomponenpembentukenzimpadabakteribintilakartanaman.
  • Klor (Cl) : berfungsisebagaipemindahharatanaman, meningkatkanosmosesel, mencegahkehilangan air yang tidakseimbang,. Jugaberperandalamfotosistem II dariprosesfotosintesis, khususnyadalamevolusioksigen. 
  •  
  • Mangan (Mn) : Untukpenyusunanklorofil, perkecambahan, danpemasakanbuah. (http://www.slideshare.net/salminmointi/unsur-hara-mikro-dan-fungsinya)
  1. 4.      Siklus Unsur Hara tanah

Unsur hara tidak dalam keadaan terkunci dalam satu bentuk  simpanan saja, proses-proses alami secara periodik mengubahnya dari bentuk satu ke bentuk yang lain. Ini adalah proses transformasi biogeokimia berkesinambungan yang kita kenal dengan siklus unsur hara tanah. Unsur hara dalam tanah dapat dibedakan atau dikenali berdasarkan batuan asli dan mineral, larut atau diabsorbsi berupa ion-ion. Bentuk bimassa terdapat dalam jaringan makhluk hidup tumbuhan atau organisme tanah dan bentuk organik dalam jaringan mati yang berada dalam berbagai tahap pelapukan termasuk humsu tanah.

Akar tanaman dan organisme tanah mengekstrak unsur hara sebagai ion-ion organik sederhana yang dibebaskan melalui pelapukan batuan dan mineral dan bahan oeganik tanah. Tumbuhan pada khususnya hanya dapat mengambil unsur hara dalam bentuk ion-ion anorganik sederhana.

 Ketika organisme mati jaringannya ditambahkan dalam bentuk bahan organik tanah dan beberapa diantaranya dibebaskan secara tiba-tiba oleh adanya sel yang rusak. Seluruh material itu segera memulai pelapukan. Sebagian bentuk yang tahan membentuk humus tanah yang melapuknya sangat lambat.

Masing-masing siklus tersebut terdiri atas 2 kompartemen atau 2 pool, yaitu :

1.  Reservoir pool : besar, lambat bergerak, umumnya bukan komponen ekologi

2.  Exchange/Cycling pool : kecil, tapi lebih aktif bertukar dengan cepat antara organisme dengan lingkungannya.

Dari sudut biosfer secara keseluruhan, siklus biogeokimia terdiri atas :

a)     Tipe gas dimana reservoir adalah di atmosfer atau hidrosfer (lautan).

misal : siklus carbon (CO2) & siklus nitrogen (N)

b)     Tipe sedimen dimana reservoir adalah kerak bumi

 

 Image

  1. Mungkin yang dimaksud pertanyaan itu adalah bagaimana unsure tanah itu tetap terjaga yaitu dengan cara :

Budidaya tanaman cenderung menyebabkan kemunduran lahan jika tidak diimbangi dengan pemupukan yang memadai. Kemunduran lahan tersebut antara lain disebabkan oleh semakin menurunya kesuburan, kerusakan sifat fisik dan biologis, serta menipisnya ketebalan tanah. Berkurang keseuburan terjadi karena tanah kehilangan  unsur hara dari daerah perakaran melalui panen, pencucian, erosi, dan denitrifikasi. Kerusakan sifat-sifat fisik dan biologis tanah antara lain berupa rusaknya agregat tanah, berkurangnya kemantapan struktur, berkurangnya kadar bahan organik, serta berkurangnya jumlah dan aktivitas mikroorganime yang hidup di dalam tanah. Sementara itu, berkurang-nya ketebalan tanah terjadi karena erosi. Upaya peningkatan kesuburan tanah dapat dilakukan dengan pemberian pupuk.

Pemupukan bertujuan  menambah unsur hara tertentu di dalam tanah yang tidak cukup bagi kebutuhan tanaman. Terdapat kecenderungan peningkatan jumlah (dosis) dan jenis (macam unsur hara) pupuk yang harus diberikan seiring dengan semakin lamanya budidaya tanaman pada sebidang lahan.

Pemupukan sebaiknya dilakukan berdasarkan asas keseimbangan. Pem-berian pupuk yang mengandung unsur hara tertentu secara berlebihan akan mengganggu penyerapan unsur h

ara lainnya. Hasil maksimal dari suatu upaya pemupukan akan diperoleh jika dilakukan dengan tepat meliputi dosis, jenis, waktu, dan cara pemberiannya.

Sumber:

(http://sulsel.litbang.deptan.go.id/ind/index.php?option=com_content&view=article&id=116:metode-penentuan-kebutuhan-hara-pada-tanaman-jeruk&catid=44:buletin-volume-i-nomor-i-tahun-2005&Itemid=235)

(http://titalama.wordpress.com/2010/04/18/siklus-hara/)

http://oryza-sativa135rsh.blogspot.com/2011/06/kesuburan-tanah.html

 

 

 

 

 

 

TANAMAN MENGKUDU

                                       BUDIDAYA MENGKUDU,
 PERTANYAAN AGUS SUPRIYANTO BUAT MATERI AGRISTYAN

1.Berasal dari manakah mengkudu?

2.Berapa ketinggian mengkudu?

3.Apa saja fungsi mengkudu?

4.Sebutkan jenis-jenis mengkudu?

5.Apa keunggulan mengkudu?

 

JAWABAN

1.Tanaman mengkudu pada awal mulanya terpusat di Polinesia, India, dan Cina. Yang kemudian menyebar sampai ke Malaysia, Australia, New Zealand, Kepulauan Pasifik, Tihiti, Hawai, Peurto Rico, Karibia dan Kanada, sampai ke Indonesia. Tanaman mengkudu dikenal sebagai raja dari jenis buah yang ada.

2.Tanaman mengkudu merupakan tanaman tahunan (perenial) yang berbentuk perdu, dengan ketinggian antara 3-8 m. batang tanaman keras dan berkayu yang tumbuh ke atas serta mempunyai banyak percabangan. Cabang-cabang tumbuh mendatar dengan arah keluar kanopi tanaman. Daun termasuk daun tunggal, terdiri atas satu helai daun setiap satu tangkai daun (petiolus). Berbentuk lonjong, dengan ukuran panjang antara 10-40 cm dan lebar antara 15-17 cm, tergantung tingkat kesuburan tanaman. Permukaan daun bagian atas berwarna hijau mengkilap, sedagkap permukaan bagian bawah berwarna hijau agak pucat. Tangkai daun pendek dan melekat pada batang atau cabang secara berselang-seling atau berpasangan. Semakin subur pertumbuhan tanman, semakin rimbun dan besar ukuran daunnya.

Image

3.Tanaman mengkudu tergolong tanaman yang serba guna. Tanaman ini dapat dijadikan penghias halaman atau di kebun secara khusus sepeti di lahan kering tegalan. Bagian tanamn yang paling penting dalam kehidupan sehari-hari adalah daun dan buahnya. Daun mengkudu mempunyai rasa yang agaklangu atau sedikit pahit, tetapi mempunyai kandungan vitamin A yang tinggi hamper sema dengan daun kacang panjang, daun katuk, daun singkong, wiortel, dan daun papaya. Buah mengkudu stadium muda dapat digunakan sebagai rujak bebeg. Hasil penelitian menunjukan bahwa zat penting yang terkandung dalam buah mengkudu terdiri atas terpenoid, pewarna, anti bakteri, asam glukuronat, gum arab, galaktosa, arabinosa, rhamnos, nutrisi, skopoletin, zat anti kanker (damnacanthal) dan xeronine serta proxeronine.

  Daun mengkudu dapat dimanfaatkan sebagai sayuran, antara lain pepes daun mengkudu, gangan, urap, gilai dan lalap matang. Atau bisa juga hanya dengan direbusdan dimakn dengan sambal. Sedangkan buah mengkudu dapat diolah menjadi sari buah (juice) mengkudu dan dodol mengkudu.

Selain dimanfaatkan ebagai sayuran, mengkudu dapat juga digunakan sebagi penyembuh penyakit. Daun muda mengkudu berkhasiat sebagai anti kanker, obat peluruh empedu, sakit ginjal, hipertensi, luka, masuk angin (sebagai tapal di perut), disentri, diabetes mellitus, jantung koroner, kolesterol tinggi dan meningkatkan stamina.

Image

4.Jenis – jenis mengkudu :

 Berdasarkan penampilan fisiknya (morfologi) buahnya, mengkudu dapat dibedakan menjadi 2 macam yaitu Mengkudu berbiji dan mengkudu tidak berbiji. (http://um.ac.id) Keduanya berkhasiat sebagai obat, tetapi mengkudu tidak berbiji sangat jarang ditanam atau dikenal orang. Semua genus Mengkudu termasuk dalam Genus Morinda, Famili Rubiaceae. Menurt Steenis (1975), genus ini mencakup 80 spesies. Penyebarannya dari India sampai  pulau-pulau di Samudra Pasifik. Mengkudu merupakan tumbuhan tropis, yang tergolong tumbuhan ever green. (http://ksupointer.com)
            Di dalam buku Ensiklopedia Indonesia menyebutkan ada 2 spesies mengkudu yang pertama Morinda citrifolia yang berdaun lonjong besar, berwarna hijau mengkilap. Kedua, Morinda eliptica  yang berdaun jorong meruncing. Keduanya ternasuk dalam suku Rubiaceae (kopi-kopian). Sementara itu dalam Heyna (2001), menyebutkan beberapa spesies mengkudu antara lain Morinda citrifolia, Morinda braceata, Morinda spesiosa, Morinda elliptica, Morinda tincloria, dan Morinda oleifera. 
            Beberapa spesies mengkudu yang memiliki nilai ekonomis antara lain Morinda officinalis, Morinda angustifolia, dan Morinda tomentosa, karena semua bagian akar dan batangnya mengandung  zat morindin yang  dapat di ekstrak dan dijadikan sebagai zat pewarna. Hasil ekstraknya dapat digunakan untuk mewarnai kain katun menjadi berwarna kuning, merah, atau coklat. Zat pewarna alami ini ditemukan oleh orang Eropa, Perkembangan industri yang mendorong mereka untuk mencari bahan-bahan industri sampai  wilayah Pasifik. Setelah melakukan penelitian mereka menemukan zat yang mampu mewarnai dari akar Mengkudu tersebut, yang disebut dengan morindone atau morindin. Dari  hasil penemuan inilah nama ilmiah Morinda diturunkan untuk Mengkudu.
            Dari berbagai jenis mengkudu, jenis Morinda citrifolia adalah yang paling dikenal oleh  masyarakat Indonesia, karena memang penyebaran jenis ini adalah yang paling luas. Morinda citrifolia dibedakan atas dua varietas  yaitu Morinda citrifolia var citrifolia dan Morinda citrifolia var braceata (Roxb). Varietas yang kedua memiliki cuping yang mirip daun, berbentuk lanset memanjang, panjangnya 1-1,5 cm, batangnya lebih lurus dan daunnya lebih kecil daripada var citrifolia.
            Morinda citrifolia var bracteata, dikenal masyarakat Jawa sebagai mengudu Maluku, karena asalnya dari Indonesia Timur. Dimana mengkudu dapat tumbuh dengan lebat di hutan dekat pantai. Var bracteata dapat digunakan untuk mengusir cacing perut. 

 Image

5. Di dalam buah mengkudu terkandung zat-zat yang berkaitan dengan kesehatan dan telah dibuktikan hanya terdapat di dalam mengkudu. Tanaman mengkudu mengandung berbagai vitamin, mineral, enzim alkaloid, ko-faktor dan sterol tumbuhan yang terbentuk secara alamiah. Komposisi kimia yang

terkandung dalam tiap bagian mengkudu Senyawa-senyawa penting dalam mengkudu yang berkaitan dengan kesehatan

sebagai berikut :Hasil penelitian Aalbersberg (1993) menyatakan bahwa kandungan karoten pada daun mengkudu lebih tinggi dibanding dengan yang terkandung dalam sayuran Brassi cacinensis 
dan Colocasia esculenta. Sedangkan pada bunganya terkandung senyawa glikosidaantrakinon, asam kapron dan asam kaprilat (Bushnel et al, 1950). Senyawa-senyawa yang lebih berperan dalam pengobatan dan kesehatan yaitu yang terkandung dalam buahnya seperti asam askorbat yang cukup tinggi dan merupakan sumber vitamin C yang luar biasa. Hasil analisa Solomon (1998) mengemukakan bahwa di dalam 1.000 g sari buah mengkudu terkandung 1.200 mg Vit. C, sehingga berkhasiat

sebagai anti oksidan yang sangat baik. Antioksidan berkhasiat menetralisir partikel-partikel berbahaya (radikal bebas) yang terbentuk dari hasil sampingan dalam proses metabolisme. Radikal bebas dapat merusak sistim kekebalan tubuh dan materi genetik. Selain itu, dari hasil penelitiannya buah mengkudu juga mengandung zat-zat nutrisi yang dibutuhkan tubuh seperti karbohidrat,

protein, vitamin, dan mineralmineral esensial.Menurutnya senyawa selenium adalah salah satu contoh mineral yang terdapat dalam mengkudu dan juga merupakan anti oksidan yang hebat.Bangsa polinesia dan penduduk asli kepulauan Pasifik Selatan sejak dulu sampai sekarang menggunakan buah mengkudu sebagai makanan, terutama untuk mempertahankan hidup sehat pada waktu krisis pangan.Senyawa terpenoid yang terkandung dalam mengkudu merupakan senyawa yang sangat penting bagi tubuh,

zat-zat terpen berfungsi membantu sintesa organik dan pemulihan sel-sel dalam tubuh (Waha, 2001). Bushnel etal. (1950) mengemukakan bahwa buah mengkudu mengandung zat-zat seperti Ascubin, L. asperuloside, alizarin dan beberapa zat antraquinon.Menurutnya Zat-zat tersebut terbukti sebagai zat anti bakteri infeksi seperti, Proteus morganii, Bassilus subtilis, Staphylococus aureus, Pseudomonas

aeruginosa dan Echerichia coli. Selain itu juga dapat mengontrol jenis-jenis bakteri yang mematikan

(patogen) seperti Salmonella dan Sigella (Waha, 2001).Mengkudu mengandung zat anti kanker yang dinamakan damnacantha (Hiramatsu et al., 1993). Zat tersebut paling efektif melawan sel-sel abnormal dibanding zat-zat antikanker yang terdapat dalam tumbuhan lainnya. Zat scopoletin dalam buah mengkudu ditemukan pada tahun 1993 oleh para peneliti di Universtas Hawaii (Waha,2001). Selanjutnya dikemukakan bahwa zat scopoletin dapat memperlebar saluran pembuluh darah yang menyempit dan melancarkan peredaran darah. Selain itu scopoletin juga dapat membunuh beberapa tipe bakteri dan bersifat fungisida terhadap bakteri Pythium sp dan bersifat anti peradangan dan alergi.

Buah mengkudu mengandung zat proxeronin dalam jumlah besar yang dapat dibentuk menjadi xeronin

(Heinicke dalam Waha, 2001). Selanjutnya dikemukakan bahwa dalam usus manusia terdapat enzim proxeronase yang dapat mengubah proxeronin menjadi xeronin. Fungsi utama xeronin

dalam tubuh adalah mengatur bentuk dan kekerasan (rigiditas) protein-protein spesifik di dalam sel. Bila fungsi protein-protein menyimpang, maka tubuh akan mengalami gangguan kesehatan

sumber : (http://yprawira.wordpress.com/budidaya-aneka-tanaman-mengkudu/)

(http://forum.upi.edu/index.php?topic=15667.0)

 

 

 

manfaat tanaman alpukat

                                                 MANFAAT TANAMAN ALPUKAT

PERTANYAAN DARI EKO PRASETYO UNTUK MAKALAH DWIMA ZULPA MAULANA

1.Tanah yang cocok bagi tanaman alpukat itu apa?

2.Apa manfaat lain dari alpukat yang telah anda jelaskan?

3.Maksud dari lemak takjemu dalam tanaman alpukat itu apa?

4.Bagaimana penanaman alpukat dengan baik?

5.Apa hama pada tanaman alpukat?

 

JAWABAN

1. Berdasarkan sifat ekologis, tanaman alpukat terdiri dari 3 tipe keturunan/ras, yaitu:.

– Ras Meksiko

Berasal dari dataran tinggi Meksiko dan Equador beriklim semi tropis dengan ketinggian antara 2.400-2.800 m dpl. Ras ini mempunyai daun dan buahnya yang
berbau adas. Masa berbunga sampai buah bisa dipanen lebih kurang 6 bulan. Buah kecil dengan berat 100-225 gram, bentuk jorong (oval), bertangkai pendek,
kulitnya tipis dan licin. Biji besar memenuhi rongga buah. Daging buah mempunyai kandungan minyak/lemak yang paling tinggi. Ras ini tahan terhadap suhu dingin.

– Ras Guatemala

Berasal dari dataran tinggi Amerika Tengah beriklim sub tropis dengan ketinggian sekitar 800-2.400 m dpl. Ras ini kurang tahan terhadap suhu dingin (toleransi
sampai -4,5 derajat C). Daunnya tidak berbau adas. Buah mempunyai ukuran yang cukup besar, berat berkisar antara 200-2.300 gram, kulit buah tebal, keras,
mudah rusak dan kasar (berbintil-bintil). Masak buah antara 9-12 bulan sesudah berbunga. Bijinya relatif berukuran kecil dan menempel erat dalam rongga, dengan kulit biji yang melekat. Daging buah mempunyai kandungan minyak yang sedang.

– Ras Hindia Barat

Berasal dari dataran rendah Amerika Tengah dan Amerika Selatan yang beriklim tropis, dengan ketinggian di bawah 800 m dpl. Varietas ini sangat peka terhadap suhu rendah, dengan toleransi sampai minus 2 derajat C. Daunnya tidak berbau adas, warna daunnya lebih terang dibandingkan dengan kedua ras yang lain. Buahnya berukuran besar dengan berat antara 400-2.300 gram, tangkai pendek, kulit buah licin agak liat dan tebal. Buah masak 6-9 bulan sesudah berbunga. Biji besar dan sering lepas di dalam rongga, keping biji kasar. Kandungan minyak dan daging buahnya paling rendah. (http://www.iptek.net.id/ind/warintek/?mnu=6&ttg=2&doc=2a1)

2.Manfaat Buah Alpukat Untuk Kesehatan

Mencegah resiko penyakit strokeKandungan Asam Folat dalam Buah Avokad ini berpotensi mencegah resiko penyakit stroke. Caranya cukup dengan makan satu buah alpukat dalam sehari secara rutin.

Menangkal radikal bebasKandungan Vitamin E, C atupun flavonoid akan menagkal radikal bebas. Sedangkan radikal bebas adlah penyebab utama timbulnya penyakt kanker. Konsumsi saja setip hari.

Menjaga kesehatan mataKandungan vitamin A dalam buah alpukat  berperan dalam melindungi mata dari degenerasi katarak dan makula.

Menjaga kesehatan jantungKandungan asam folat yang tinggi akan menjaga kesehatan jantung. Satu gelas alpukat mengandung sekitar 23% dari total asam folat yang dibutuhkan tubuh. 

Penyembuh Sakit MaagKalau terkan sakit maag ringan makan sari biji buah alpukat. Karena buah ini bisa mengoabati penyakit maag yang menyerang anda.

 

Mencegah kanker prostat

Senyawa yang terkandung dalam buah alpukat dapat mencari sel kanker yang baru timbul dan kemudian menghancurkannya tanpa merusak sel-sel kesehatan lainnya.

Membantu Turunkan Kolesterol
Kandungan beta-sitosterol yang cukup tinggi, senyawa ini telah terbukti ampuh menurunkan kadar kolesterol. 

Manfaat Buah Alpukat utnuk kecantikan

Untuk mata yang bengkak. 

Caranya Ambil alpukat, kemudian potong menjadi beberapa bagian kecil berbentuk bulan sabit. Kemudian, sambil berbaring, tempatkan beberapa potong di bagian bawah mata, dan diamkan selama 20 menit. lalu bilas dengan air bersih.

 

Untuk Masker wajah 

Caranya Potong alpukat menjadi dua bagian. Kemudian blender 1/2 bagian, tambahkan madu sebanyak 1/4 cangkir. Ratakan pada wajah. Biarkan selama 15 menit, kemudian bersihkan dengan air hangat. Cara ini sangat cocok untuk kulit kering

 

Rambut lembut dan bersinar. 

Caranya Campurkan sepotong alpukat (1/2 rambut pendek), sebutir kuning telur, 1/2 sendok teh minyak zaitun. Ratakan pada rambut dan biarkan selama 30 menit atau lebih. Kemudian bersihkan dengan shampo dan conditioner seperti biasa.

Tangan halus dan lembut. 

Caranya Campurkan 1/4 bagian dari alpukat dengan 1 butir putih telur, 2 sendok makan outmeal, dan satu sendok makan lemon joice. Campurkan lalu ratakan pada tangan. Diamkan selama 20 menit, kemudian bersihkan dengan air hangat dan keringkan.

 

Kalau kita ingin manfaat buah alpukat yang maksimal sesering mungkin kita mengkonsumsi buah alpukat. Bisa anda buat Jus alpukat yang manis, jika anda bosan mengkonsumsinya langsung.

Tapi bagi yang malas atau ribet untuk membuat jus alpukat, anda bisa beli jus alpukat di warung atau restoran terkenal. Selain itu, Anda juga bisa membaca artikel tentang manfaat minyak zaitun. Semoga manfaat buah alpukat diatas bisa bermanfaat.

(http://e-lifestylenews.blogspot.com/2012/10/manfaat-buah-alpukat-untuk-kesehatan_2.html)

Image

3. Lemak Tidak Jenuh, merupakan lemak baik yang kandungan kolesterol LDL (Low  Density Lipoprotein)-nya lebih sedikit dibandingkan yang terdapat dalam lemak jenuh. Menurut para ahli, jenis ini dapat meningkatkan antibodi pada tubuh, menurunkan kolesterol HDL, dan menurunkan risiko serangan jantung. Sedangkan lemak  jenuh dan lemak trans, banyak membawa kolesterol HDL dalam darah yang mengakibatkan plak menempel pada saluran pembuluh  darah, hingga mengganggu system peredaran darah dan suplai oksigen dalam tubuh. Nah, yang sifatnya mengentalkan darah ini adalah trigliserida. Trigliserida merupakan lemak dalam darah, yang merupakan hasil uraian tubuh pada makanan yang  mengandung lemak dan kolesterol, yang telah dikonsumsi dan masuk ke tubuh serta juga dibentuk di hati. Dalam jumlah yang normal (tidak lebih dari 150 mg/dl), ia berfungsi sebagai partikel yang mengangkat lemak dalam tubuh. Ketika berlebih, otomatis menghambat kelancaran peredaran darah, karena bersifat viskositas (kental) itu tadi. Akibatnya, kita akan merasa kaku di daerah leher atau jari-jari tangan. Efek jangka panjangnya, menimbulkan penyakit jantung, diabetes dan ginjal.

 

(http://alifauzan.web.id/lemak-tidak-jenuh.html)

4. Perbanyakan tanaman: Tanaman diperbanyak dengan okulasi atau sambung pucuk. Bibit dapat disambung pada umur 1-8 bulan. Perbanyakan dengan biji hanya untuk batang bawah. Budi daya tanaman: Bibit okulasi (sambungan) ditanam pada jarak 12 m x 12 m. Ukuran lubang tanam 60 cm x 60 cm x 40 cm. Pupuk kandang yang diberikan 30 kg/lubang. Pupuk buatan berupa campuran 25-1000 g urea, 25-1000 g TSP, dan 25-800 g KCl per pohon diberikan tiga bulan sekali. Dosis pemberian pupuk meningkat sesuai dengan umur tanaman. Sebaiknya dalam satu areal ditanam dua tipe alpukat. Sekurangkurangnya 5-10% dari jumlah bibit yang ditanam berasal dari tipe lain sebagai sumber tepung sari (pejantan). Untuk memudahkan perawatan, dianjurkan penanaman dilakukan menjelang musim hujan

(http://ayobertani.wordpress.com/2009/05/20/budidaya-alpukat-ijo-panjang/)

 

5.HAMA TANAMAN ALPUKAT :

1) Ulat kipat (Cricula trisfenestrata Helf)

Ciri: Panjang tubuh 6 cm, berwarna hitam bercak-bercak putih dan dipenuhi rambut putih. Kepala dan ekor berwarna merah menyala.

Gejala: Daun-daun tidak utuh dan terdapat bekas gigitan. Pada serangan yang hebat, daun habis sama sekali tetapi tanaman tidak akan mati, dan terlihat kepompong bergelantungan.

Pengendalian: Menggunakan insektisida yang mengandung bahan aktif monokrotofos atau Sipermetein, misal Cymbush 50 EC dengan dosis 1-3 cc/liter
atau Azodrin 15 WSC dengan dosis 2-3 cc/liter.

2) Ulat kupu-kupu gajah (Attacus atlas L.)

Ciri: Sayap kupu-kupu dapat mencapai ukuran 25 cm dengan warna coklat kemerahan dan segitiga tansparan. Ulat berwarna hijau tertutup tepung putih,
panjang 15 cm dan mempunyai duri yang berdaging. Pupa terdapat di dalam kepompong yang berwarna coklat.

Gejala: Sama dengan gejala serangan ulat kipat, tetapi kepompong tidak bergelantungan melainkan terdapat di antara daun.

Pengendalian: Sama dengan pemberantasan ulat kipat.

3) Aphis gossypii Glov/A. Cucumeris, A. cucurbitii/Aphis kapas.

Ciri: Warna tubuh hijau tua sampai hitam atau kunig coklat. Hama ini mengeluarkan embun madu yang biasanya ditumbuhi cendawan jelaga sehingga daun menjadi hitam dan semut berdatangan.

Gejala: Pertumbuhan tanaman terganggu. Pada serangan yang hebat tanaman akan kerdil dan terpilin.

Pengendalian: Disemprot dengan insektisida berbahan aktif asefat/dimetoat, misalnya Orthene 75 SP dengan dosis 0,5-0,8 gram/liter atau Roxion 2 cc/liter.

4) Kutu dompolan putih (Pseudococcus citri Risso)/Planococcus citri Risso

Ciri: Bentuk tubuh elips, berwarna coklat kekuningan sampai merah oranye, tertutup tepung putih, ukuran tubuh 3 mm, mempunyai tonjolan di tepi tubuh dengan jumlah 14-18 pasang dan yang terpanjang di bagian pantatnya.

Gejala: Pertumbuhan tanaman terhambat dan kurus. Tunas muda, daun, batang, tangkai bunga, tangkai buah, dan buah yang terserang akan terlihat pucat, tertutup massa berwarna putih, dan lama kelamaan kering.

Pengendalian: Disemprot dengan insektisida yang mengandung bahan aktif formotion, monokrotofos, dimetoat, atau karbaril. Misalnya anthion 30 EC dosis 1-1,5 liter/ha, Sevin 85 S dosis 0,2% dari konsentrasi fomula.

5) Tungau merah (Tetranychus cinnabarinus Boisd)

Ciri: Tubuh tungau betina berwarna merah tua/merah kecoklatan, sedangkan tungau jantan hijau kekuningan/kemerahan. Terdapat beberapa bercak hitam, kaki
dan bagian mulut putih, ukuran tubuh 0,5 mm.

Gejala: Permukaan daun berbintik-bintik kuning yang kemudian akan berubah menjadi merah tua seperti karat. Di bawah permukaan daun tampak anyaman benang yang halus. Serangan yang hebat dapat menyebabkan daun menjadi layu dan rontok.

Pengendalian: Disemprot dengan akarisida Kelthan MF yang mengandung bahan aktif dikofoldan, dengan dosis 0,6-1 liter/ha.

7.2. Hama pada Buah

1) Lalat buah Dacus (Dacus dorsalis Hend.)

Ciri: Ukuran tubuh 6 – 8 mm dengan bentangan sayap 5 – 7 mm. Bagian dada berwarna coklat tua bercak kuning/putih dan bagian perut coklat muda dengan
pita coklat tua. Stadium larva berwarna putih pada saat masih muda dan kekuningan setelah dewasa, panjang tubuhnya 1 cm.

Gejala: Terlihat bintik hitam/bejolan pada permukaan buah, yang merupakan tusukan hama sekaligus tempat untuk meletakkan telur. Bagian dalam buah berlubang dan busuk karena dimakan larva.

Pengendalian: Dengan umpan minyak citronella/umpan protein malation akan mematikan lalat yang memakannya. Penyemprotan insektisida dapat dilakukan antara lain dengan Hostathion 40 EC yang berbahan aktif triazofos dosis 2 cc/liter dan tindakan yang paling baik adalah memusnahkan semua buah yang terserang atau membalik tanah agar larva terkena sinar matahari dan mati.

2) Codot (Cynopterus sp)

Ciri: Tubuh seperti kelelawar tetapi ukurannya lebih kecil menyerang buah-buahan pada malam hari.

Gejala: Terdapat bagian buah yang berlubang bekas gigitan. Buah yang terserang hanya yang telah tua, dan bagian yang dimakan adalah daging buahnya saja.

Pengendalian: Menangkap codot menggunakan jala/menakut-nakutinya menggunakan kincir angin yang diberi peluit sehingga dapat menimbulkan suara.

7.3. Hama pada Cabang/Ranting

1) Kumbang bubuk cabang (Xyleborus coffeae Wurth / Xylosandrus morigerus Bldf).

Ciri: Kumbang yang lebih menyukai tanaman kopi ini berwarna coklat tua dan berukuran 1,5 mm. Larvanya berwarna putih dan panjangnya 2 mm.

Gejala: Terdapat lubang yang menyerupai terowongan pada cabang atau ranting. Terowongan itu dapat semakin besar sehingga makanan tidak dapat tersalurakan ke daun, kemudian daun menjadi layu dan akhirnya cabang atau ranting tersebut mati.

Pengendalian: Cabang/ranting yang terserang dipangkas dan dibakar. Dapat juga disemprot insektisida berbahan aktif asefat atau diazinon yang
terkandung dalam Orthene 75 SP dengan dosis pemberian 0,5-0,8 gram/liter dan Diazinon 60 EC dosis 1-2 cc/liter.