DEFINISI TANAH

                                            DEFINISI TANAH,
 PERTANYAAN AYUB NOVSEL SATYA SITUMORANG DARI MATERI DESDYAN RIZKI PRATAMA

1.Sifat Kimia Tanah?

2.Kesuburan biologi tanah meliputi apa saja? Apa itu?

3.Unsur Hara Mikro?

4.Siklus Unsur Hara tanah dapat dibedakan dengan?

5.Metode Pendekatan Kandungan unsur hara tanah?

 JAWABAN

1. Beberapa Sifat Kimia Tanah antara lain :

Derajat Kemasaman Tanah (pH)
Reaksi tanah menunjukkan sifat kemasaman atau alkalinitas tanah yang dinyatakan dengan nilai pH. Nilai pH menunjukkan banyaknya konsentrasi ion hidrogen (H+) di dalam tanah. Makin tinggi kadar ion H+ didalam tanah, semakin masam tanah tersebut. Di dalam tanah selain H+ dan ion-ion lain ditemukan pula ion OH-, yang jumlahnya berbanding terbalik dengan banyaknya H+. pada tanah-tanah masam jumlah ion H+ lebih tinggi daripada OH-, sedang pada tanah alkalis kandungan OH- lebih banyak daripada H+. Bila kandungan H+ sama dengan OH- , maka tanah bereaksi netral yaitu mempunyai pH = 7 (Anonim 1991).

Nilai pH berkisar dari 0-14 dengan pH 7 disebut netral sedangkan pH kurang dari 7 disebut masam dan pH lebih dari 7 disebut alkalis. Walaupun dcmikian pH tanah umumnya berkisar dari 3,0-9,0. Di Indonesia unumnya tanahnya bereaksi masam dengan 4,0 – 5,5 sehingga tanah dengan pH 6,0 – 6,5 sering telah dikatakan cukup netral meskipun sebenarnya masih agak masam. Di daerah rawa-rawa sering ditemukan tanah-tanah sangat masam dengan pH kurang dari 3,0 yang disebut tanah sangat masam karena banyak mengandung asam sulfat. Di daerah yang sangat kering kadang-kadang pH tanah sangat tinggi (pH lebih dari 9,0) karena banyak mengandung garam Na (Anonim 1991).

C-Organik
Kandungan bahan organik dalam tanah merupakan salah satu faktor yang berperan dalam menentukan keberhasilan suatu budidaya pertanian. Hal ini dikarenakan bahan organik dapat meningkatkan kesuburan kimia, fisika maupun biologi tanah. Penetapan kandungan bahan organik dilakukan berdasarkan jumlah C-Organik (Anonim 1991).
Bahan organik tanah sangat menentukan interaksi antara komponen abiotik dan biotik dalam ekosistem tanah. Musthofa (2007) dalam penelitiannya menyatakan bahwa kandungan bahan organik dalam bentuk C-organik di tanah harus dipertahankan tidak kurang dari 2 persen, Agar kandungan bahan organik dalam tanah tidak menurun dengan waktu akibat proses dekomposisi mineralisasi maka sewaktu pengolahan tanah penambahan bahan organik mutlak harus diberikan setiap tahun. Kandungan bahan organik antara lain sangat erat berkaitan dengan KTK (Kapasitas Tukar Kation) dan dapat meningkatkan KTK tanah. Tanpa pemberian bahan organik dapat mengakibatkan degradasi kimia, fisik, dan biologi tanah yang dapat merusak agregat tanah dan menyebabkan terjadinya pemadatan tanah (Anonim 1991).

N-Total
Nitrogen merupakan unsur hara makro esensial, menyusun sekitar 1,5 % bobot tanaman dan berfungsi terutama dalam pembentukan protein (Hanafiah 2005).
Menurut Hardjowigeno (2003) Nitrogen dalam tanah berasal dari :
a.Bahan Organik Tanah : Bahan organik halus dan bahan organik kasar
b.Pengikatan oleh mikroorganisme dari N udara
c.Pupuk
d.Air Hujan
Sumber N berasal dari atmosfer sebagai sumber primer, dan lainnya berasal dari aktifitas didalam tanah sebagai sumber sekunder. Fiksasi N secara simbiotik khususnya terdapat pada tanaman jenis leguminoseae sebagai bakteri tertentu. Bahan organik juga membebaskan N dan senyawa lainnya setelah mengalami proses dekomposisi oleh aktifitas jasad renik tanah.
Hilangnya N dari tanah disebabkan karena digunakan oleh tanaman atau mikroorganisme. Kandungan N total umumnya berkisar antara 2000 – 4000 kg/ha pada lapisan 0 – 20 cm tetapi tersedia bagi tanaman hanya kurang 3 % dari jumlah tersebut (Hardjowigeno 2003). Manfaat dari Nitrogen adalah untuk memacu pertumbuhan tanaman pada fase vegetatif, serta berperan dalam pembentukan klorofil, asam amino, lemak, enzim, dan persenyawaan lain (RAM 2007). Nitrogen terdapat di dalam tanah dalam bentuk organik dan anorganik. Bentuk-bentuk organik meliputi NH4, NO3, NO2, N2O dan unsur N. Tanaman menyerap unsur ini terutama dalam bentuk NO3, namun bentuk lain yang juga dapat menyerap adalah NH4, dan urea (CO(N2))2 dalam bentuk NO3. Selanjutnya, dalam siklusnya, nitrogen organik di dalam tanah mengalami mineralisasi sedangkan bahan mineral mengalami imobilisasi. Sebagian N terangkut, sebagian kembali scbagai residu tanaman, hilang ke atmosfer dan kembali lagi, hilang melalui pencucian dan bertambah lagi melalui pemupukan. Ada yang hilang atau bertambah karena pengendapan.

P-Bray
Unsur Fosfor (P) dalam tanah berasal dari bahan organik, pupuk buatan dan mineral-mineral di dalam tanah. Fosfor paling mudah diserap oleh tanaman pada pH sekitar 6-7 (Hardjowigeno 2003). Siklus Fosfor sendiri dapat dilihat pada Gambar 2.
Dalam siklus P terlihat bahwa kadar P-Larutan merupakan hasil keseimbangan antara suplai dari pelapukan mineral-mineral P, pelarutan (solubilitas) P-terfiksasi dan mineralisasi P-organik dan kehilangan P berupa immobilisasi oleh tanaman fiksasi dan pelindian (Hanafiah 2005).
Menurut Leiwakabessy (1988) di dalam tanah terdapat dua jenis fosfor yaitu fosfor organik dan fosfor anorganik. Bentuk fosfor organik biasanya terdapat banyak di lapisan atas yang lebih kaya akan bahan organik. Kadar P organik dalam bahan organik kurang lebih sama kadarnya dalam tanaman yaitu 0,2 – 0,5 %. Tanah-tanah tua di Indonesia (podsolik dan litosol) umumnya berkadar alami P rendah dan berdaya fiksasi tinggi, sehingga penanaman tanpa memperhatikan suplai P kemungkinan besar akan gagal akibat defisiensi P (Hanafiah 2005). Menurut Foth (1994) jika kekurangan fosfor, pembelahan sel pada tanaman terhambat dan pertumbuhannya kerdil.

Kalium (K)
Kalium merupakan unsur hara ketiga setelah Nitrogen dan Fosfor yang diserap oleh tanaman dalam bentuk ion K+. Muatan positif dari Kalium akan membantu menetralisir muatan listrik yang disebabkan oleh muatan negatif Nitrat, Fosfat, atau unsur lainnya. Hakim et al. (1986), menyatakan bahwa ketersediaan Kalium merupakan Kalium yang dapat dipertukarkan dan dapat diserap tanaman yang tergantung penambahan dari luar, fiksasi oleh tanahnya sendiri dan adanya penambahan dari kaliumnya sendiri.
Kalium tanah terbentuk dari pelapukan batuan dan mineral-mineral yang mengandung kalium. Melalui proses dekomposisi bahan tanaman dan jasad renik maka kalium akan larut dan kembali ke tanah. Selanjutnya sebagian besar kalium tanah yang larut akan tercuci atau tererosi dan proses kehilangan ini akan dipercepat lagi oleh serapan tanaman dan jasad renik. Beberapa tipe tanah mempunyai kandungan kalium yang melimpah. Kalium dalam tanah ditemukan dalam mineral-mineral yang terlapuk dan melepaskan ion-ion kalium. Ion-ion adsorpsi pada kation tertukar dan cepat tersedia untuk diserap tanaman. Tanah-tanah organik mengandung sedikit Kalium.

Natrium (Na)

Natrium merupakan unsur penyusun lithosfer keenam setelah Ca yaitu 2,75% yang berperan penting dalam menentukan karakteristik tanah dan pertumbuhan tanaman terutama di daerah kering dan agak kering yang berdekatan dengan pantai, karena tingginya kadar Na di laut, suatu tanah disebut tanah alkali jika KTK atau muatan negatif koloid-koloidnya dijenuhi oleh ≥ 15% Na, yang mencerminkan unsur ini merupakan komponen dominan dari garam-garam larut yang ada. Pada tanah-tanah ini, mineral sumber utamanya adalah halit (NaCl). Kelompok tanah alkalin ini disebut tanah halomorfik, yang umumnya terbentuk di daerah pesisir pantai iklim kering dan berdrainase buruk. Sebagaimana unsur mikro, Na juga bersifat toksik bagi tanaman jika terdapat dalam tanah dalam jumlah yang sedikit berlebihan (Hanafiah, 2005).

Kalsium (Ca)
Kalsium tergolong dalam unsur-unsur mineral essensial sekunder seperti Magnesium dan Belerang. Ca2+ dalam larutan dapat habis karena diserap tanaman, diambil jasad renik, terikat oleh kompleks adsorpsi tanah, mengendap kembali sebagai endapan-endapan sekunder dan tercuci (Leiwakabessy 1988). Adapun manfaat dari kalsium adalah mengaktifkan pembentukan bulu-bulu akar dan biji serta menguatkan batang dan membantu keberhasilan penyerbukan, membantu pemecahan sel, membantu aktivitas beberapa enzim (RAM 2007).

Magnesium (Mg)

Magnesium merupakan unsur pembentuk klorofil. Seperti halnya dengan beberapa hara lainnya, kekurangan magnesium mengakibatkan perubahan warna yang khas pada daun. Kadang-kadang pengguguran daun sebelum waktunya merupakan akibat dari kekurangan magnesium (Hanafiah 2005).

Kapasitas Tukar Kation (KTK)

Kapasitas tukar kation (KTK) merupakan sifat kimia yang sangat erat hubungannya dengan kesuburan tanah. Tanah-tanah dengan kandungan bahan organik atau kadar liat tinggi mempunyai KTK lebih tinggi daripada tanah-tanah dengan kandungan bahan organik rendah atau tanah-tanah berpasir (Hardjowogeno 2003). Nilai KTK tanah sangat beragam dan tergantung pada sifat dan ciri tanah itu sendiri. Besar kecilnya KTK tanah dipengaruhi oleh :
1.Reaksi tanah
2.Tekstur atau jumlah liat
3.Jenis mineral liat
4.Bahan organik dan,
5.Pengapuran serta pemupukan.
Soepardi (1983) mengemukakan kapasitas tukar kation tanah sangat beragam, karena jumlah humus dan liat serta macam liat yang dijumpai dalam tanah berbeda-beda pula.

Kejenuhan Basa (KB)

Kejenuhan basa adalah perbandingan dari jumlah kation basa yang ditukarkan dengan kapasitas tukar kation yang dinyatakan dalam persen. Kejenuhan basa rendah berarti tanah kemasaman tinggi dan kejenuhan basa mendekati 100% tanah bersifal alkalis. Tampaknya terdapat hubungan yang positif antara kejenuhan basa dan pH. Akan tetapi hubungan tersebut dapat dipengaruhi oleh sifat koloid dalam tanah dan kation-kation yang diserap. Tanah dengan kejenuhan basa sama dan komposisi koloid berlainan, akan memberikan nilai pH tanah yang berbeda. Hal ini disebabkan oleh perbedaan derajat disosiasi ion H+ yang diserap pada permukaan koloid (Anonim 1991).
Kejenuhan basa selalu dihubungkan sebagai petunjuk mengenai kesuburan sesuatu tanah. Kemudahan dalam melepaskan ion yang dijerat untuk tanaman tergantung pada derajat kejenuhan basa. Tanah sangat subur bila kejenuhan basa > 80%, berkesuburan sedang jika kejenuhan basa antara 50-80% dan tidak subur jika kejenuhan basa < 50 %. Hal ini didasarkan pada sifat tanah dengan kejenuhan basa 80% akan membebaskan kation basa dapat dipertukarkan lebih mudah dari tanah dengan kejenuhan basa 50% (Anonim 1991).

(http://boymarpaung.wordpress.com/2009/02/19/sifat-kimia-tanah/)

 Image

2. KESUBURAN TANAH SECARA BIOLGI

 

Tanah dikatakan subur bila mempunyai kandungan dan keragaman biologi yang tinggi

 

 

 

 

Table 1. Maximum number and biomass (live weight) of soil organisms in a highly fertile grassland soil

 

Kind of organism

Abundance

(no/m2)

Biomass

(g/m2)

Bacteria

3 x 1014

300

Fungi

 

400

Protozoa

5 x 108

38

Nematodes

107

12

Earthworms and related forms

105

132

Mites

2 x 105

3

Springtails

5 x 104

5

Other invertebrates (snails, millipedes, etc)

2 x 103

36

From: B.N. Richards (1974) Introduction to the Soil Ecosystem

 

Organisme (mikroorganisme) tanah penting dalam kesuburan tanah karena

  1. berperan dalam siklus energi
  2. berperan dalam siklus hara
  3. berperan dalam pembentukan agregat tanah
  4. menentukan kesehatan tanah (suppressive / conducive terhadap munculnya penyakit terutama penyakit tular tanah-soil borne pathogen)

 

. Siklus energi

–          Sumber energi utama adalah matahari yang diubah oleh tanaman melalui proses fotosintesis menjadi bahan organik

–          Beberapa mikroorganisme mampu melakukan fotosinthesis (menangkap energi matahari: algae)

–          Sumber energi yang lain adalah hasil oksidasi-reduksi mineral anorganik: S dan Fe

–          Energi dalam bahan organik dimanfaatkan oleh organisme/mikroorganisme

–          Organisme dekomposer: milipede dll.

–          Mikroorganisme dekomposer: jamur dan bakteri

–          Mikroorganisme yang tumbuh di rhizosfer memanfaatkan energi dalam eksudat akar: bakteri Azotobacter

 

. Siklus hara

Mikroorganisme mempunyai peran yang sangat penting dalam siklus hara karena:

  1. ukurannya yang kecil sehingga mempunyai rasio permukaan:volume yang sangat besar

Þ memungkinkan pertukaran material (hara) dari sel ke lingkungannya dengan sangat cepat

  1. reproduksi yang sangat cepat (dalam hitungan menit)
  2. distribusi keberadaan yang sangat luas

 

Macam-macam siklus hara penting

  1. Siklus Nitrogen

–           Pool N terbesar di udara sebagai gas N2

–          N menjadi tersedia melalui proses fiksasi (kimia maupun mikrobiologis)

(nitrogen fixer: rhizobium dll)

–          N organik (dalam jaringan mahluk hidup – bentuk protein, asam amino dan asam nukleat) menjadi N anorganik melalui proses mineralisasi  NH4+ (ammonium) == MO dekomposer

–           NH4+  mengalami Nitrifikasi oleh Nitrosomonas, Nitrosococcus dan Nitrosovibrio

–          NO2  menjadi NO3  oleh Nitrobacter dan Nitrococcus

–          NO3  mengalami Denitrifikasi menjadi NO2  oleh Pseudomonas, Bacillus dan Alcaligenes

–          N anorganik dapat diasimilasi oleh mikroorganisme == Imobilisasi

 

 

  1. Siklus Sulfur

–          Oksidasi sulfur menjadi sulfat oleh Thiobacillus, Arthrobacter dan Bacillus

2H2S + O2   ® 2S + 2H2O

2S + 2H2O + 3O2   ®  2SO42- + 4H+

S2O32-  + H2O  + 2O2   ®  2SO42- + 2H+

 

–          Reduksi Sulfat menjadi sulfida (S2-) oleh Desulphovibrio desulphuricans

2SO42- + 4H2   ®  S2- + 4H2O

  1. Siklus fosfor

–          Fosfor di alam dalam bentuk terikat sebagai Ca-fosfat, Fe- atau Al-fosfat, fitat atau protein

–          Mikroorganisme (Bacillus, Pseudomonas, Xanthomonas, Aerobacter aerogenes) dapat melarutkan P menjadi tersedia bagi tanaman

 

 Pembentukan agregat tanah

–          organisme tanah menghasilkan polimer organik (misal humic dan fulvic acids) yang mengikat partikel lempung menjadi mikro agregat

–          pembentukan mikroagregat menjadi makro agregat dimediasi oleh bahan organik dan berbagai jenis mikro dan makroorganisme (bakteri, jamur-terutama jamur VAM, algae, cacing, semut, serangga dsb.).

 

. Kesehatan tanah

–          tanah suppressive terhadap patogen tular tanah umumnya mempunyai total mikroorganisme yang lebih besar dari tanah yang kondusif

–          kompetisi nutrisi

–          Amuba memakan jamur

–          populasi Pseudomonas spp (antagonistic bakteria) atau Trichoderma tinggi

Soil                                                      Fungi              Trichoderma

Fort Collins (condusive)(clay loam)                   2 x 103                1 x 102

Colombia (suppressive)(organic)                       1 x 108                8 x 105

PENILAIAN KESUBURAN TANAH

 

Penilaian kesuburan tanah merupakan proses yg mendiagnosis permasalahan unsure hara dan menerapkan anjuran dlm hal pemupukan.

Proses mendiagnosis msl unsur hara tnm dan menetapkan anjuran pupuk di wil tropika didasarkan pd pendekatan yg berbeda pd tahap kecanggihan yg berlainan

Program penilaian kesuburan tanah dpt dipilahkan menjadi: uji-tanah, analisis tanaman, omission element di rumah kaca, uji coba pupuk sederhana

 

  1. Berdasarkan pada uji-tanah

–          Salah satu pendekatan yg terpopuler

–          Dikembangkan oleh International Soil Fertility Evaluation and Improvement Program, ISFEIP.

–          Kesuburan tanah terutama bersangkut dg unsure hara tnm dan kead tanah

–          Penilaian menyangkut tk ketersediaan & kesetimbangan hara di dalam tanah, termasuk cara yg tepat untuk menaksir seluruh faktor tsb (uji-tanah, analisis tnm, sigi tanah, kead iklim)

–          Perbaikan meliputi penamb pupuk buatan, gamping, pupuk alam, dan tambahan lain pd tanah dlm jml, waktu & cara ttt, shg dpt memberi lingkungan hara yg optimum utk memperoleh hsl panen

–          Program penilaian & perbaikan tanah adl khas-tempat & khas keadaan.

–          Penggunaan informasi yg bijaksana mencakup pertimb thd bbrp faktor yg pengaruhi prod, tng kerja, ekonomi & ekologi

–          Hanya uji-tanah saja tidak dianggap sbg cara pendekatan yg memuaskan

–          Nilai yg diperoleh dlm analisis tanah adl angka empiris yg hanya berarti bila dikorelasikan dg tanggapan hasil

–          Menurut Fitts (1974) melibatkan :

    1. pengambilan contoh (tanah dan tanaman),  CT hrs benar2 mewakili tapak, krn hanya diuji sepermilyarnya
    2. analisis laboratorium (tanah dan tanaman), perlu metode yg sesuai dan benar
    3. hubungan antara analisis dan tanggapan hasil, di rumah kaca & uji coba lapangan
    4. penafsiran dan anjuran, berdasarkan hasil
    5. memanfaatkan informasi
    6. penelitian

 

  1. Berdasarkan analisis tanaman

–          berkembang di daerah tanpa system uji-tanah efektif

–          untuk tanaman tahunan dan jangka panjang

–          Keuntungannya: merangkumkan pengaruh peubah tanah, tanaman, iklim & pengelolaan

–          merup ukuran terakhir ketersediaan unsur hara

–          kerugiannya: terlambat untuk memperbaiki kondisi hara tanpa menderita kerugian hasil

–          Tujuan:

    1. Untuk mengenali masalah keharaan dan menetapkan jumlah perbaikannya melalui penentuan tingkat gawat
    2. Menghitung nilai penyerapan unsur hara sbg kunci utk penggunaan pupuk
    3. Memantau unsur hara tnm tahunan

 

  1. Berdasarkan pemantauan unsur hara yang hilang

–          Termsk menanam tnm penunjuk di dlm rumah kaca atau di lap pd tanah yg diberi pupuk scr omission element

–          Mnrt Chaminade (1972), informasi yg diperoleh adl:

    1. unsur hara yang kahat
    2. kepentingan nisbi kekahatan itu
    3. tingkat yg tunjukkan terkurasnya kesuburan akibat pemotongan/penebangan

 

  1. Uji coba pupuk scr sederhana di ladang petani

–          dikembangakan oleh Food and Agricultural Organization (FAO)

–          bertujuan utk memperkenalkan pupuk sbg sarana utk menaikkan hsl panen di tropika

–          mengesampingkan keaneka ragaman tanah setempat

–          tidak dapat dibuat anjuran khas-tempat

 

  1. Hubungan antara kesuburan tanah dan penggolongan tanah

–          anjuran penggunaan pupuk adalah khas-tempat

–          perbedaan sifat tanah merup salah satu penyebab utama utk kekhasan menurut tempat

–          program penilaian kesuburan tanah hrs berhub erat dg program penyigian dan penggolongan tanah

 

 

3.Unsur Hara Mikro

  • I PengertianUnsur Hara
    Unsur Hara adalahsenyawaorganikdananorganis yang adadidalamtanahataudengankata lain nutrisi yang terkandungdalamtanah
    Unsur Hara sangatdibutuhkanuntuktumbuhkembangtanaman. Berdasarkantingkatkebutuhannyamakadapatdigolongkanmenjadi 2 bagianyaituUnsur Hara MakrodanUnsur Hara Mikro
  • II DefinisiUnsur Hara Mikro
    Unsurharamikro, yaitu: sumbermakanan yang diperlukandalamjumlah yang relatifsedikit, namunsangatpentingdanmutlakdiperlukanolehtanamansebagaimakanan. Padahaliniunsurharamikrobanyakdiperolehdaribahanorganik yang adapadatanah
  • Sumberunsurharamikro : batu-batu mineral, air irigasidansisa-sisabahanorganis. Padaumumnyahanyasedikitdiperlukan, antarabeberapa gram sampai kilogram bagikeperluan 1 herktartanahdanpadaumumnyamerupakanzatkatalisatoratauzat yang dapatmempercepatpersenyawaankimiawidalamtubuhtanaman.
  • III FungsiUnsur Hara Mikro
    7 unsurharamikro yang dibutuhkantanamandalamjumlahkecilantara lain Besi(Fe), Mangaan(Mn), Tembaga (Cu), Seng (Zn), Boron (B), Molibden (Mo),, Klor(Cl). BerikutMasing-masingunsurharaesensialtidakdapatsalingmenggantikan.
  • G. klorofil
    Ferrit/besi (Fe) : dibutuhkantanamandalampembentukanklorofil, berperanpadaproses-prosesfisiologistanamansepertiprosespernapasan, selainitubesiberfungsisebagaiaktifatordalamprosesbiokimiadidalamtanaman, danpembentukbeberapaenzim.
  • Tembaga/Cupprum (Cu) : beperansebagaiaktfiatorenzimdalamprosespenyimpanancadanganmakanan, katalisatordalamprosespernapasandanperombakankarbohidrat, dansebagaisalahsatuelemendalamprosespembentukan vitamin A dansecaratidaklangsungberperandalampembentukanklorofil.
  • Seng/zink (Zn) :Kegunaansengsangatpentingantara lain sebagaikatalisatordalampembentukanprotein,mengaturpembentukanasam yang berfungsisebagaizatpengaturtumbuhtanaman. Ketersediaansengdalamtanah 1-20Ppm, sedangkankebutuhan normal tanaman 25-125ppm.
  • Boron (B) : Unsuriniberfungsimenangkutkarbohidratkedalamtubuhtanamandanmenghisapunsurkalsium. Selainitu boron berfungsidalamperkembanganbagian-bagiantanamanuntuktumbuhaktif. Gejaldefisiensiharamikroiniantara lain : pertumbuhanterhambatpadajaringanmeristematik (pucukakar), matipucuk (die back), mobilitasrendah, buah yang sedangberkembangsngatrentan, mudahterserangpenyakit. 
  • Molibden (Mo) : berperansebagaipengikat nitrogen  yang bebasdiudarauntukpembentukan protein danmenjadikomponenpembentukenzimpadabakteribintilakartanaman.
  • Klor (Cl) : berfungsisebagaipemindahharatanaman, meningkatkanosmosesel, mencegahkehilangan air yang tidakseimbang,. Jugaberperandalamfotosistem II dariprosesfotosintesis, khususnyadalamevolusioksigen. 
  •  
  • Mangan (Mn) : Untukpenyusunanklorofil, perkecambahan, danpemasakanbuah. (http://www.slideshare.net/salminmointi/unsur-hara-mikro-dan-fungsinya)
  1. 4.      Siklus Unsur Hara tanah

Unsur hara tidak dalam keadaan terkunci dalam satu bentuk  simpanan saja, proses-proses alami secara periodik mengubahnya dari bentuk satu ke bentuk yang lain. Ini adalah proses transformasi biogeokimia berkesinambungan yang kita kenal dengan siklus unsur hara tanah. Unsur hara dalam tanah dapat dibedakan atau dikenali berdasarkan batuan asli dan mineral, larut atau diabsorbsi berupa ion-ion. Bentuk bimassa terdapat dalam jaringan makhluk hidup tumbuhan atau organisme tanah dan bentuk organik dalam jaringan mati yang berada dalam berbagai tahap pelapukan termasuk humsu tanah.

Akar tanaman dan organisme tanah mengekstrak unsur hara sebagai ion-ion organik sederhana yang dibebaskan melalui pelapukan batuan dan mineral dan bahan oeganik tanah. Tumbuhan pada khususnya hanya dapat mengambil unsur hara dalam bentuk ion-ion anorganik sederhana.

 Ketika organisme mati jaringannya ditambahkan dalam bentuk bahan organik tanah dan beberapa diantaranya dibebaskan secara tiba-tiba oleh adanya sel yang rusak. Seluruh material itu segera memulai pelapukan. Sebagian bentuk yang tahan membentuk humus tanah yang melapuknya sangat lambat.

Masing-masing siklus tersebut terdiri atas 2 kompartemen atau 2 pool, yaitu :

1.  Reservoir pool : besar, lambat bergerak, umumnya bukan komponen ekologi

2.  Exchange/Cycling pool : kecil, tapi lebih aktif bertukar dengan cepat antara organisme dengan lingkungannya.

Dari sudut biosfer secara keseluruhan, siklus biogeokimia terdiri atas :

a)     Tipe gas dimana reservoir adalah di atmosfer atau hidrosfer (lautan).

misal : siklus carbon (CO2) & siklus nitrogen (N)

b)     Tipe sedimen dimana reservoir adalah kerak bumi

 

 Image

  1. Mungkin yang dimaksud pertanyaan itu adalah bagaimana unsure tanah itu tetap terjaga yaitu dengan cara :

Budidaya tanaman cenderung menyebabkan kemunduran lahan jika tidak diimbangi dengan pemupukan yang memadai. Kemunduran lahan tersebut antara lain disebabkan oleh semakin menurunya kesuburan, kerusakan sifat fisik dan biologis, serta menipisnya ketebalan tanah. Berkurang keseuburan terjadi karena tanah kehilangan  unsur hara dari daerah perakaran melalui panen, pencucian, erosi, dan denitrifikasi. Kerusakan sifat-sifat fisik dan biologis tanah antara lain berupa rusaknya agregat tanah, berkurangnya kemantapan struktur, berkurangnya kadar bahan organik, serta berkurangnya jumlah dan aktivitas mikroorganime yang hidup di dalam tanah. Sementara itu, berkurang-nya ketebalan tanah terjadi karena erosi. Upaya peningkatan kesuburan tanah dapat dilakukan dengan pemberian pupuk.

Pemupukan bertujuan  menambah unsur hara tertentu di dalam tanah yang tidak cukup bagi kebutuhan tanaman. Terdapat kecenderungan peningkatan jumlah (dosis) dan jenis (macam unsur hara) pupuk yang harus diberikan seiring dengan semakin lamanya budidaya tanaman pada sebidang lahan.

Pemupukan sebaiknya dilakukan berdasarkan asas keseimbangan. Pem-berian pupuk yang mengandung unsur hara tertentu secara berlebihan akan mengganggu penyerapan unsur h

ara lainnya. Hasil maksimal dari suatu upaya pemupukan akan diperoleh jika dilakukan dengan tepat meliputi dosis, jenis, waktu, dan cara pemberiannya.

Sumber:

(http://sulsel.litbang.deptan.go.id/ind/index.php?option=com_content&view=article&id=116:metode-penentuan-kebutuhan-hara-pada-tanaman-jeruk&catid=44:buletin-volume-i-nomor-i-tahun-2005&Itemid=235)

(http://titalama.wordpress.com/2010/04/18/siklus-hara/)

http://oryza-sativa135rsh.blogspot.com/2011/06/kesuburan-tanah.html

 

 

 

 

 

 

Leave a Reply

Fill in your details below or click an icon to log in:

WordPress.com Logo

You are commenting using your WordPress.com account. Log Out / Change )

Twitter picture

You are commenting using your Twitter account. Log Out / Change )

Facebook photo

You are commenting using your Facebook account. Log Out / Change )

Google+ photo

You are commenting using your Google+ account. Log Out / Change )

Connecting to %s

%d bloggers like this: